Эта статья входит в число добротных статей

FASTA

Материал из Википедии — свободной энциклопедии
Перейти к навигации Перейти к поиску
формат FASTA
Расширение .fas, .fasta, .fna, .ffn, .faa, .frn, .afa, .mfa
MIME-тип chemical/seq-aa-fasta, chemical/seq-na-fasta[1]
Разработчик Дэвид Липман[en][2]
Уильям Пирсон[en][2]
Опубликован 1985
Тип формата формат файла
Расширен из ASCII for FASTA
Развит в FASTQ
Сайт ncbi.nlm.nih.gov/BLAST/fasta.shtml

FASTA — текстовый формат для нуклеотидных или полипептидных последовательностей, в котором нуклеотиды или аминокислоты обозначаются при помощи однобуквенных кодов[⇨]. Из-за его простоты и практичности в настоящее время используется большинством программ работы с биологическими последовательностями[⇨]. Файлы данного формата могут содержать названия последовательностей, их идентификаторы[⇨] в базах данных и комментарии. В зависимости от природы содержащихся в нем биологических последовательностей, файл формата FASTA может иметь различные расширения[⇨].

История и распространение[править | править код]

Формат придуман Дэвидом Липманом[en] и Уильямом Пирсоном[en][2][3] в 1985 году для одноименной программы[en], предназначенной для поиска в больших базах последовательностей, гомологичных данной. Первичное описание формата было произведено ими в документации этой программы, а сейчас его описание является частью документации программы BLAST[4].

Простота FASTA-формата позволяет легко осуществлять различные действия с последовательностями при помощи инструментов редактирования текста и скриптовых языков программирования, таких как Python[5], Ruby[6], Perl[7], Java[8].

Форматы FASTA и FASTQ (Sanger Institute) наиболее популярны для представления данных о биологических последовательностях[9]. Существуют также другие форматы, в том числе используемые в банках данных GenBank[10], EMBL[11] и UniProt[12].

Формат[править | править код]

Последовательности в формате FASTA начинаются с однострочного описания, за которым следуют строки, содержащие собственно последовательность. Описание отмечается символом «больше» («>») в первой колонке. Слово за этим символом и до первого пробела является идентификатором последовательности[⇨], далее следует опциональное описание. Следующие несколько строк могут иметь первым символом точку с запятой («;»), и тогда они будут восприниматься как комментарии. На данный момент многие базы данных и программы не распознают комментарии, поэтому они мало распространены. Дальше следуют строки, содержащие собственно биологические последовательности. Обычно строки в формате FASTA ограничены длиной от 80 до 120 символов (по историческим причинам), но современные программы распознают последовательности, записанные полностью в одну строку. В один файл могут быть записаны несколько последовательностей, таким образом получается мульти-FASTA файл, однако перед каждой последовательностью должен стоять свой идентификатор[13]. Пример одной последовательности в формате FASTA:[14]

   >gi|31563518|ref|NP_852610.1| microtubule-associated proteins 1A/1B light chain 3A isoform b [Homo sapiens]
   MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI
   IRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFIRENE

Идентификатором этой последовательности является gi|31563518|ref|NP_852610.1|.

Последовательности записываются в виде однобуквенных кодов нуклеотидов или аминокислот, совпадающих с их стандартными однобуквенными обозначениями, принятыми IUB[en]/ИЮПАК, в порядке от 5'- к 3'-концу для нуклеиновых кислот и от N- к С-концу для аминокислот, в них допускаются пробелы, символы могут быть как в верхнем, так и в нижнем регистре. Числа, служебные символы конца строки и табуляции игнорируются программами работы с последовательностями[4].

Нуклеиновые кислоты обозначаются[15]:

Код Значение Мнемоника
A A Adenine — Аденин
C C Cytosine — Цитозин
G G Guanine — Гуанин
T T Thymine — Тимин (5-метилурацил)
U U Uracil — Урацил
R A, G puRine — Пурины
Y C, T, U pYrimidines — Пиримидины
K G, T, U Кетоновые основания
M A, C Основания с аминогруппами (aMino)
S C, G Сильное (Strong) взаимодействие в комплементарной паре (три водородные связи)
W A, T, U Слабое (Weak) взаимодействие в комплементарной паре (две водородные связи)
B не A (то есть C, G, T или U) B идёт за A
D не C (то есть A, G, T или U) D идёт за C
H не G (A, C, T или U) H идёт за G
V не T и не U (A, C или G) V идёт за U
N A C G T U Любой (aNy) нуклеотид

Для аминокислот есть 22 обычных кода (канонические аминокислоты, селеноцистеин и пирролизин), 4 специальных (обозначения множеств аминокислот) и * для обозначения стоп-кодона (в формальных трансляциях генов)[16][17].

Код аминокислоты Значение
A Аланин
B Аспарагиновая кислота (D) или Аспарагин (N)
C Цистеин
D Аспарагиновая кислота
E Глутаминовая кислота
F Фенилаланин
G Глицин
H Гистидин
I Изолейцин
J Лейцин (L) или Изолейцин (I)
K Лизин
L Лейцин
M Метионин
N Аспарагин
O Пирролизин
P Пролин
Q Глутамин
R Аргинин
S Серин
T Треонин
U Селеноцистеин
V Валин
W Триптофан
Y Тирозин
Z Глутаминовая кислота (E) или Глутамин (Q)
X Любая аминокислота
* Терминация трансляции

Fasta-формат используется также для файлов, содержащих выравнивания биологических последовательностей. В этом случае в каждую последовательность в места, соответствующие позициям, не представленным в данной последовательности, вставляются символы «гэпов» (обычно это дефис или точка), в результате все последовательности в файле должны иметь одинаковую длину[18].

Идентификаторы последовательностей[править | править код]

Центр NCBI определил правила создания уникальных идентификаторов последовательностей (SeqID). В строку описания допускается вносить следующие варианты идентификаторов[19]:

Тип Формат(ы) Пример(ы)
Локальный (не отсылает к внешним базам данных) lcl|целое число

lcl|строка

lcl|123

lcl|hmm271

GenInfo идентификатор последовательности остова bbs|целое число bbs|123
GenInfo тип молекулы остова bbm|целое число bbm|123
GenInfo ID импорта gim|целое число gim|123
GenBank gb|код доступа|локус gb|M73307|AGMA13GT
EMBL emb|код доступа|локус emb|CAM43271.1|
PIR pir|код доступа|название pir||G36364
SWISS-PROT sp|код доступа|название sp|P01013|OVAX_CHICK
Патент pat|страна|патент|номер последовательности pat|US|RE33188|1
Патентная заявка pgp|страна|номер заявки|номер последовательности pgp|EP|0238993|7
RefSeq ref|код доступа|название ref|NM_010450.1|
Ссылка на базу данных не из этого списка gnl|база данных|целое число

gnl|база данных|строка

gnl|taxon|9606

gnl|PID|e1632

Интегрированная база данных GenInfo gi|целое число gi|21434723
DDBJ dbj|код доступа|локус dbj|BAC85684.1|
PRF prf|код доступа|название prf||0806162C
PDB pdb|запись|цепь pdb|1I4L|D
GenBank с аннотациями от третьих лиц tpg|код доступа|название tpg|BK003456|
EMBL с аннотациями от третьих лиц tpe|код доступа|название tpe|BN000123|
DDBJ с аннотациями от третьих лиц tpd|код доступа|название tpd|FAA00017|
TrEMBL tr|код доступа|название tr|Q90RT2|Q90RT2_9HIV1

Вертикальные чёрточки («|») в списке сверху являются не разделителями, а частью формата. Можно ставить идентификаторы подряд, разделяя их чертами. В случае, если какое-то из полей идентификатора оставлено пустым, для обеспечения совместимости с программами необходимо ставить две черты подряд[20].

Расширения файлов[править | править код]

Файлы формата fasta могут иметь различное расширение в зависимости от природы представленных в них биологических данных[21][22].

Расширение Значение Примечания
fasta Обычные данные fasta Любые данные fasta. Иногда также .fa, .seq, .fsa, .fas
fna аббр. от «fasta nucleic acid» Для описания нуклеотидных последовательностей.
ffn Кодирующие участки нуклеотидов Содержат кодирующие участки геномов.
faa аббр. от «fasta amino acid» Содержат аминокислотные последовательности. Используется расширение mpfa при хранении нескольких белков в одном файле.
frn Некодирующая РНК в формате FASTA Содержат некодирующие РНК в алфавите ДНК, например тРНК, рРНК
afa, mfa Выравнивание в формате FASTA (a от «alignment», m от «multiple») Содержат выравнивания биологических (нуклеотидных или аминокислотных) последовательностей

Примечания[править | править код]

  1. FASTA (.fasta, .fa, .fna, .fsa, .mpfa). Wolfram Research, reference, 2007-2012. (англ.)
  2. 1 2 3 Lipman D., Pearson W. Rapid and sensitive protein similarity searches (англ.) // Science. — 1985. — 22 March (vol. 227, no. 4693). — P. 1435—1441. — ISSN 0036-8075. — doi:10.1126/science.2983426. [исправить]
  3. Pearson W. R., Lipman D. J. Improved tools for biological sequence comparison. (англ.) // Proceedings of the National Academy of Sciences. — 1988. — 1 April (vol. 85, no. 8). — P. 2444—2448. — ISSN 0027-8424. — doi:10.1073/pnas.85.8.2444. [исправить]
  4. 1 2 BLAST topics. A. Query Input and database selection. Accepted Input Formats. 1. FASTA. NCBI. Дата обращения 30 мая 2020.
  5. Peter J. A. Cock, Tiago Antao, Jeffrey T. Chang, Brad A. Chapman, Cymon J. Cox. Biopython: freely available Python tools for computational molecular biology and bioinformatics (англ.) // Bioinformatics. — 2009-06-01. — Vol. 25, iss. 11. — P. 1422–1423. — ISSN 1367-4803. — doi:10.1093/bioinformatics/btp163.
  6. Naohisa Goto, Pjotr Prins, Mitsuteru Nakao, Raoul Bonnal, Jan Aerts. BioRuby: bioinformatics software for the Ruby programming language (англ.) // Bioinformatics. — 2010-10-15. — Vol. 26, iss. 20. — P. 2617–2619. — ISSN 1367-4803. — doi:10.1093/bioinformatics/btq475.
  7. Jason E. Stajich, David Block, Kris Boulez, Steven E. Brenner, Stephen A. Chervitz. The Bioperl Toolkit: Perl Modules for the Life Sciences (англ.) // Genome Research. — 2002-10-01. — Vol. 12, iss. 10. — P. 1611–1618. — ISSN 1549-5469 1088-9051, 1549-5469. — doi:10.1101/gr.361602.
  8. Aleix Lafita, Spencer Bliven, Andreas Prlić, Dmytro Guzenko, Peter W. Rose. BioJava 5: A community driven open-source bioinformatics library (англ.) // PLOS Computational Biology. — 2019-08-02. — Vol. 15, iss. 2. — P. e1006791. — ISSN 1553-7358. — doi:10.1371/journal.pcbi.1006791.
  9. EMBOSS Users Guide. emboss.open-bio.org. Дата обращения 22 мая 2020.
  10. Sample GenBank Record. www.ncbi.nlm.nih.gov. Дата обращения 19 мая 2020.
  11. European Nucleotide Archive annotated/assembled sequences User Manual (англ.) (txt). European Nucleotide Archive. European Bioinformatics Institute (12 March 2020). Дата обращения 8 июня 2020.
  12. UniProt Knowledgebase User Manual (англ.). ExPASy Bioinformatics Resource Portal (22 April 2020). Дата обращения 8 июня 2020.
  13. Multi-FASTA format - Metagenomics. www.metagenomics.wiki. Дата обращения 19 мая 2020.
  14. Ta Schoenfeld, L McKerracher, R Obar, Rb Vallee. MAP 1A and MAP 1B are structurally related microtubule associated proteins with distinct developmental patterns in the CNS (англ.) // The Journal of Neuroscience. — 1989-05-01. — Vol. 9, iss. 5. — P. 1712–1730. — ISSN 1529-2401 0270-6474, 1529-2401. — doi:10.1523/JNEUROSCI.09-05-01712.1989.
  15. : Tao Tao. Single Letter Codes for Nucleotides. NCBI Learning Center. National Center for Biotechnology Information (24 августа 2011). Дата обращения 15 марта 2012.
  16. Codes Used in Sequence Description (англ.). www.ddbj.nig.ac.jp. Дата обращения 16 апреля 2020.
  17. IUPAC-IUB Joint Commission on Biochemical Nomenclature (JCBN). Nomenclature and symbolism for amino acids and peptides. Recommendations 1983 (англ.) // Biochemical Journal. — 1984. — 15 April (vol. 219, no. 2). — P. 345—373. — ISSN 0264-6021. — doi:10.1042/bj2190345. [исправить]
  18. Aligned FASTA Format. www.cgl.ucsf.edu. Дата обращения 22 мая 2020.
  19. NCBI C++ Toolkit Book. FASTA Sequence ID Format. NCBI C++ Toolkit. Дата обращения 30 мая 2020.
  20. Leonard Shonda A., Littlejohn Timothy G., Baxevanis Andreas D. Common File Formats (англ.) // Current Protocols in Bioinformatics. — 2006. — December (vol. 16, no. 1). — ISSN 1934-3396. — doi:10.1002/0471250953.bia01bs16. [исправить]
  21. Zahoorullah S MD. A Textbook of Biotechnology. — SM Online Publishers LLC, 2015. — С. 6-7. — ISBN 9780996274531.
  22. Alignment Fileformats. www.jalview.org. Дата обращения 1 апреля 2020.

Ссылки[править | править код]